PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g45510.1.p
Common NameBRADI_1g45510, LOC100842092
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 320aa    MW: 35716.6 Da    PI: 6.7818
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g45510.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.8e-191461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WTteEde+l ++++++G g+W++ ++  g++R++k+c++rw +yl
  Bradi1g45510.1.p 14 KGPWTTEEDEKLMNYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding57.63e-1867112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++++eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  Bradi1g45510.1.p  67 RGKFSQEEEQTILQLHSILGNK-WSAIAKHLP-GRTDNEIKNFWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.467961IPR017930Myb domain
SuperFamilySSF466891.42E-3211108IPR009057Homeodomain-like
SMARTSM007179.7E-151363IPR001005SANT/Myb domain
PfamPF002491.9E-171461IPR001005SANT/Myb domain
CDDcd001671.00E-111661No hitNo description
PROSITE profilePS5129427.81462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2865117IPR009057Homeodomain-like
SMARTSM007171.2E-1766114IPR001005SANT/Myb domain
PfamPF002493.6E-1767112IPR001005SANT/Myb domain
CDDcd001671.42E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRPPCSDDN GVKKGPWTTE EDEKLMNYIQ KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LKPDIKRGKF SQEEEQTILQ LHSILGNKWS AIAKHLPGRT DNEIKNFWNT HLRKKLIKMG  120
IDPMTHRPRT DFFSALPQLI ALANFRQFLE QQPLDDQTAW LQSEAVQAAK LQYMQSLLHS  180
AASIVASPTT TSSSLNPLTT DLEQISFLSP PQMLSPRVLE GIGGTELAGQ APQNQMPSIT  240
YDHSIGNINV KSDEQRHGEG ENISQKRMLL SENSLPPLAD MPASNTCDIS TSNCNCIISP  300
LPSWSEILLD EELMSDCLM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-30141164105C-Myb DNA-Binding Domain
1mse_C1e-30141164105C-Myb DNA-Binding Domain
1gv2_A1e-30141164105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP3304810.0KP330481.1 Triticum aestivum MYB transcription factor SM152-2 mRNA, complete cds.
GenBankKP3304820.0KP330482.1 Triticum aestivum MYB transcription factor SM152-3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560902.10.0PREDICTED: myb-related protein Hv1-like
TrEMBLI1GZN80.0I1GZN8_BRADI; Uncharacterized protein
STRINGBRADI1G45510.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-100myb domain protein 93